£24.99
TB-500 5mg - High-Quality Research Peptide TB 500, also known as Thymosin Beta 4, is a synthetic peptide that consists of 43 amino acids. It is derived from the naturally...

TB-500 5mg - High-Quality Research Peptide

TB 500, also known as Thymosin Beta 4, is a synthetic peptide that consists of 43 amino acids. It is derived from the naturally occurring protein Thymosin Beta 4, which plays a role in tissue repair and regeneration in the body. TB 500 has gained attention for its potential therapeutic benefits, particularly in promoting healing and reducing inflammation in various tissues.

One of the notable aspects of TB 500 is its suggested role in weight loss and fat reduction. While its primary function is in tissue repair, some research and anecdotal evidence suggest that TB 500 may also aid in promoting fat loss. This potential effect is thought to be linked to its ability to enhance recovery and repair processes, which could indirectly support metabolic function and weight management.

AXIOM Health, a reputable peptide supplier, offers TB 500 in 5mg vials. They guarantee a purity level of 99%, which has been verified by third-party testing. This high purity ensures that the peptide meets rigorous quality standards, maximizing its effectiveness and safety for research and experimental purposes.

Researchers and individuals interested in the potential benefits of TB 500, including its purported role in weight loss, can rely on AXIOM Health for a reliable and pure source of this peptide. It is important to note that while TB 500 shows promise in various applications, including potential weight management benefits, further research is needed to fully understand its mechanisms and effectiveness in these areas.

  • Product Name: TB-500 5mg
  • Catalogue Number: TB500-5mg
  • Molecular Formula: C212H350N56O78S
  • Molecular Weight: 4963.4 g/mol
  • Purity: ≥99%
  • Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
  • Form: Lyophilised Solid

Usage and Storage:

TB-500 is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For best results, follow our website's detailed reconstitution and storage guidelines.

Synthesis and Quality Assurance:

TB-500 is meticulously synthesised through a controlled process that guarantees high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards researchers require.

Legal and Safety Information:

UK-Peptides proudly provides TB-500 strictly for scientific and research use. In alignment with our dedication to supporting the research community, we ensure our products meet stringent quality standards and legal requirements. Please note that our peptides, including TB-500, are not designed for human consumption or clinical application.

If you require high-quality TB-500 for your research in the UK, explore our range of peptides designed for scientific rigour and innovation.

We use Royal Mail and DPD courier services to deliver orders. Delivery to any address in the UK takes just 1-3 business days, ensuring you receive your order quickly and efficiently. Enjoy fast and reliable shipping with every purchase.
Just added to your wishlist:
My Wishlist
You've just added this product to the cart:
Go to cart page